PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000144751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 343aa    MW: 38618.1 Da    PI: 7.5198
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000144751genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +lv++++++G g+W+t ++  g++R++k+c++rw +yl
    MDP0000144751 14 KGPWSPEEDHKLVHYIQKHGHGRWRTLPKNAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding551.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W+tIa++++ gRt++++k++w+++
    MDP0000144751  67 RGRFSMEEEETIIQLHSVLGNK-WSTIASRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.081961IPR017930Myb domain
SuperFamilySSF466894.12E-3111108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001673.08E-111661No hitNo description
PROSITE profilePS5129425.57662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665116IPR009057Homeodomain-like
SMARTSM007177.6E-1566114IPR001005SANT/Myb domain
PfamPF002493.5E-1567111IPR001005SANT/Myb domain
CDDcd001674.19E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGKNPCCETN GLKKGPWSPE EDHKLVHYIQ KHGHGRWRTL PKNAGLKRCG KSCRLRWANY  60
LRPDIKRGRF SMEEEETIIQ LHSVLGNKWS TIASRLPGRT DNEIKNYWNT HIRKRLLKMG  120
IDPVTHTPRL DLLELTSLLS STLYNSSSDN LQLNIPNLLS IGPIMDPELL NLAATLLTSQ  180
RRPQSSHPEF PSKNHAQQNP LALLQNNDQN QFQSNQLPNV APFLNQPLIT NFGHPCTTNG  240
ADQSSFVPIT TNQXGSYDSN YESIISHNIP GQDYQPACIS DNVNNQSFQN MCSFGSLLST  300
PSSSPATTTY ANCCTEDERD SFCSNILNMY HDIPNDLNVT QLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-30121162105C-Myb DNA-Binding Domain
1mse_C1e-30121162105C-Myb DNA-Binding Domain
1gv2_A1e-30121162105MYB PROTO-ONCOGENE PROTEIN
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008367275.10.0PREDICTED: protein ODORANT1-like
TrEMBLM5WK281e-150M5WK28_PRUPE; Uncharacterized protein
STRINGVIT_19s0014g03820.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.19e-85myb domain protein 74